PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_1650V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 608aa    MW: 66329.7 Da    PI: 8.2244
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_1650V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-17159204147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg W + Ed++l ++v q+G+ +W++Ia++++ gR++k+c++rw++ 
  Pp3c1_1650V3.1.p 159 RGHWRPAEDDKLRELVSQYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 204
                       899*****************************.***********996 PP

2Myb_DNA-binding55.31.5e-17211255147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r ++T+eE+++l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ +
  Pp3c1_1650V3.1.p 211 RRPFTEEEEDRLLAAHRFHGNK-WAMIARLFP-GRTDNAVKNHWHVV 255
                       679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.189154205IPR017930Myb domain
SuperFamilySSF466891.27E-28158252IPR009057Homeodomain-like
SMARTSM007171.9E-14158207IPR001005SANT/Myb domain
PfamPF002491.6E-16159204IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-27160212IPR009057Homeodomain-like
CDDcd001673.82E-13162203No hitNo description
PROSITE profilePS5129425.606206260IPR017930Myb domain
SMARTSM007175.4E-15210258IPR001005SANT/Myb domain
PfamPF002495.8E-14211254IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-20213259IPR009057Homeodomain-like
CDDcd001671.80E-11213256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MVTMEDRGNS WSAGATKVMG LSHSFAEETE RMQFSSGKVA HSLSQWPQNL VLFKDAVRGP  60
SFRAFSSAET ATTDGERTSI SGSDTPASKS IPFQALGIMA TDERAWCLQS VESSSGLKLS  120
SDDDMENGSI EDDMKESNED MESFLSKDGE SVQSKLCPRG HWRPAEDDKL RELVSQYGPQ  180
NWNLIAEKLQ GRSGKSCRLR WFNQLDPRIN RRPFTEEEED RLLAAHRFHG NKWAMIARLF  240
PGRTDNAVKN HWHVVMARKF RERSRVYGRR KTQVNRRGKL RSSNSGGNHQ HGSTDSLTAW  300
IEKYALSGEQ SVEACDGSGD ALAKPRASLS GSRSPTSLPS TFTNPQVSSS NLQQVSGVGS  360
NLCETSSLSP KFSSGGSVPL MAPSLLPNLG GAIGGSKPAY LPGSCSSEKH QQALLSNAMD  420
ISINSEHLTR VAEARAEKGS LHLQTPESPF VGLKTTFQGS LYAGRWGGPS LPNPFGNNPT  480
NGDKGDELYK SYSNVSCRSE MQKQLSLGRS GHQREASPSL RIAPAFSRQD TTKELGNWML  540
LPLAGQAQQQ LRERLRKDIS NSKKLGSNSW GTCEKSDDIE FSEVEPSQSS PDSAPVPFID  600
FLGVGAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-311592597107B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S200_41V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-69myb domain protein 105